Lineage for d2qs4b_ (2qs4 B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1186385Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1186386Protein automated matches [190039] (34 species)
    not a true protein
  7. 1186432Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (26 PDB entries)
  8. 1186435Domain d2qs4b_: 2qs4 B: [195736]
    automated match to d1ycjb_
    protein/RNA complex; complexed with gol, ly5, nh4

Details for d2qs4b_

PDB Entry: 2qs4 (more details), 1.58 Å

PDB Description: crystal structure of the glur5 ligand binding core dimer in complex with ly466195 at 1.58 angstroms resolution
PDB Compounds: (B:) Glutamate receptor, ionotropic kainate 1

SCOPe Domain Sequences for d2qs4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qs4b_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkyga
qndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpidsa
ddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvltt
dyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegkl
hmmkekwwrgn

SCOPe Domain Coordinates for d2qs4b_:

Click to download the PDB-style file with coordinates for d2qs4b_.
(The format of our PDB-style files is described here.)

Timeline for d2qs4b_: