Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (159 species) not a true protein |
Species Francisella tularensis [TaxId:177416] [195722] (2 PDB entries) |
Domain d4e4ya_: 4e4y A: [195723] automated match to d2d1yb_ complexed with gol, so4 |
PDB Entry: 4e4y (more details), 1.8 Å
SCOPe Domain Sequences for d4e4ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e4ya_ c.2.1.0 (A:) automated matches {Francisella tularensis [TaxId: 177416]} amanylvtggskgigkavvelllqnknhtvinidiqqsfsaenlkfikadltkqqditnv ldiiknvsfdgiflnagilikgsifdidiesikkvldlnvwssiyfikglennlkvgasi vfngsdqcfiakpnsfaytlskgaiaqmtkslaldlakyqirvntvcpgtvdtdlyrnli qkyannvgisfdeaqkqeekefplnriaqpqeiaelvifllsdkskfmtgglipidggyt aq
Timeline for d4e4ya_: