SCOPe 2.03: Domain d4e4ya_: 4e4y A:

Lineage for d4e4ya_ (4e4y A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Francisella tularensis [TaxId:177416] [195722] (2 PDB entries)

8. Domain d4e4ya_: 4e4y A: [195723]
   automated match to d2d1yb_
   complexed with gol, so4

Details for d4e4ya_

PDB Entry: 4e4y, 1.8 Å

PDB Description: The crystal structure of a short chain dehydrogenase family protein from Francisella tularensis subsp. tularensis SCHU S4

PDB Compounds: (A:) Short chain dehydrogenase family protein

SCOPe Domain Sequences for d4e4ya_:

Sequence; same for both SEQRES and ATOM records:

>d4e4ya_ c.2.1.0 (A:) automated matches {Francisella tularensis [TaxId: 177416]}
amanylvtggskgigkavvelllqnknhtvinidiqqsfsaenlkfikadltkqqditnv
ldiiknvsfdgiflnagilikgsifdidiesikkvldlnvwssiyfikglennlkvgasi
vfngsdqcfiakpnsfaytlskgaiaqmtkslaldlakyqirvntvcpgtvdtdlyrnli
qkyannvgisfdeaqkqeekefplnriaqpqeiaelvifllsdkskfmtgglipidggyt
aq

Timeline for d4e4ya_:

• d4e4ya_ first appeared in SCOPe 2.02
  
• d4e4ya_ appears in SCOPe 2.04
  
• d4e4ya_ appears in the current release, SCOPe 2.08, called d4e4ya1