SCOPe 2.08: Domain d4e4ya1: 4e4y A:1-241

Lineage for d4e4ya1 (4e4y A:1-241)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Francisella tularensis [TaxId:177416] [195722] (4 PDB entries)

8. Domain d4e4ya1: 4e4y A:1-241 [195723]
   Other proteins in same PDB: d4e4ya2
   automated match to d2d1yb_
   complexed with gol, so4

Details for d4e4ya1

PDB Entry: 4e4y, 1.8 Å

PDB Description: The crystal structure of a short chain dehydrogenase family protein from Francisella tularensis subsp. tularensis SCHU S4

PDB Compounds: (A:) Short chain dehydrogenase family protein

SCOPe Domain Sequences for d4e4ya1:

Sequence; same for both SEQRES and ATOM records:

>d4e4ya1 c.2.1.0 (A:1-241) automated matches {Francisella tularensis [TaxId: 177416]}
manylvtggskgigkavvelllqnknhtvinidiqqsfsaenlkfikadltkqqditnvl
diiknvsfdgiflnagilikgsifdidiesikkvldlnvwssiyfikglennlkvgasiv
fngsdqcfiakpnsfaytlskgaiaqmtkslaldlakyqirvntvcpgtvdtdlyrnliq
kyannvgisfdeaqkqeekefplnriaqpqeiaelvifllsdkskfmtgglipidggyta
q

Timeline for d4e4ya1:

• d4e4ya1 first appeared in SCOPe 2.02, called d4e4ya_
  
• d4e4ya1 appears in SCOPe 2.07