Lineage for d2jjwa_ (2jjw A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2032239Domain d2jjwa_: 2jjw A: [195721]
    automated match to d1igml_

Details for d2jjwa_

PDB Entry: 2jjw (more details), 1.7 Å

PDB Description: structure of human signal regulatory protein (sirp) gamma
PDB Compounds: (A:) signal regulatory protein gamma

SCOPe Domain Sequences for d2jjwa_:

Sequence, based on SEQRES records: (download)

>d2jjwa_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqmiqpeklllvtvgktatlhctvtsllpvgpvlwfrgvgpgreliynqkeghfprvttv
sdltkrnnmdfsirissitpadvgtyycvkfrkgspenvefksgpgtemalgakp

Sequence, based on observed residues (ATOM records): (download)

>d2jjwa_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqmiqpeklllvtvgktatlhctvtsllpvgpvlwfrgvgpgreliynqkeghfprvttv
sdltkrnnmdfsirissitpadvgtyycvkfrknvefksgpgtemalgakp

SCOPe Domain Coordinates for d2jjwa_:

Click to download the PDB-style file with coordinates for d2jjwa_.
(The format of our PDB-style files is described here.)

Timeline for d2jjwa_: