Lineage for d3t3pc_ (3t3p C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1135268Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1135580Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (1 family) (S)
  5. 1135581Family b.69.8.1: Integrin alpha N-terminal domain [69319] (1 protein)
  6. 1135582Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 1135583Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (15 PDB entries)
    Uniprot P08514 32-483
  8. 1135587Domain d3t3pc_: 3t3p C: [195699]
    automated match to d3niga_
    complexed with ca, cl, gol, mg, nag, so4

Details for d3t3pc_

PDB Entry: 3t3p (more details), 2.2 Å

PDB Description: a novel high affinity integrin alphaiibbeta3 receptor antagonist that unexpectedly displaces mg2+ from the beta3 midas
PDB Compounds: (C:) integrin alpha-IIb

SCOPe Domain Sequences for d3t3pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t3pc_ b.69.8.1 (C:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqpv

SCOPe Domain Coordinates for d3t3pc_:

Click to download the PDB-style file with coordinates for d3t3pc_.
(The format of our PDB-style files is described here.)

Timeline for d3t3pc_: