Lineage for d3ttma_ (3ttm A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2163017Protein automated matches [190140] (30 species)
    not a true protein
  7. 2163202Species Pseudomonas aeruginosa [TaxId:287] [195694] (2 PDB entries)
  8. 2163203Domain d3ttma_: 3ttm A: [195698]
    automated match to d1a99a_
    complexed with put

Details for d3ttma_

PDB Entry: 3ttm (more details), 2 Å

PDB Description: Crystal structure of SpuD in complex with putrescine
PDB Compounds: (A:) Polyamine transport protein

SCOPe Domain Sequences for d3ttma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ttma_ c.94.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dnkvlhvynwsdyiapdtlekftketgikvvydvydsnevleakllagksgydvvvpsns
flakqikagvyqkldksklpnwknlnkdlmhtlevsdpgnehaipymwgtigigynpdkv
kaafgdnapvdswdlvfkpeniqklkqcgvsfldspteilpaalhylgykpdtdnpkelk
aaeelflkirpyvtyfhsskyisdlangnicvaigysgdiyqaksraeeaknkvtvkyni
pkegagsffdmvaipkdaentegalafvnflmkpeimaeitdvvqfpngnaaatplvsea
irndpgiypseevmkklytfpdlpaktqramtrswtkiksg

SCOPe Domain Coordinates for d3ttma_:

Click to download the PDB-style file with coordinates for d3ttma_.
(The format of our PDB-style files is described here.)

Timeline for d3ttma_: