Lineage for d3ttkb_ (3ttk B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1185375Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1186093Protein automated matches [190140] (9 species)
    not a true protein
  7. 1186180Species Pseudomonas aeruginosa [TaxId:287] [195694] (2 PDB entries)
  8. 1186183Domain d3ttkb_: 3ttk B: [195696]
    automated match to d1a99a_

Details for d3ttkb_

PDB Entry: 3ttk (more details), 2.97 Å

PDB Description: Crystal structure of apo-SpuD
PDB Compounds: (B:) Polyamine transport protein

SCOPe Domain Sequences for d3ttkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ttkb_ c.94.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dnkvlhvynwsdyiapdtlekftketgikvvydvydsnevleakllagksgydvvvpsns
flakqikagvyqkldksklpnwknlnkdlmhtlevsdpgnehaipymwgtigigynpdkv
kaafgdnapvdswdlvfkpeniqklkqcgvsfldspteilpaalhylgykpdtdnpkelk
aaeelflkirpyvtyfhsskyisdlangnicvaigysgdiyqaksraeeaknkvtvkyni
pkegagsffdmvaipkdaentegalafvnflmkpeimaeitdvvqfpngnaaatplvsea
irndpgiypseevmkklytfpdlpaktqramtrswtkiks

SCOPe Domain Coordinates for d3ttkb_:

Click to download the PDB-style file with coordinates for d3ttkb_.
(The format of our PDB-style files is described here.)

Timeline for d3ttkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ttkc_