Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) |
Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
Protein automated matches [190066] (5 species) not a true protein |
Species Oryza sativa [TaxId:39947] [195635] (2 PDB entries) |
Domain d3axkt_: 3axk T: [195638] Other proteins in same PDB: d3axka1, d3axka2, d3axkb1, d3axkb2 automated match to d1wdds_ complexed with gol, mg, ndp |
PDB Entry: 3axk (more details), 1.9 Å
SCOPe Domain Sequences for d3axkt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3axkt_ d.73.1.1 (T:) automated matches {Oryza sativa [TaxId: 39947]} xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqcisfiaykp
Timeline for d3axkt_: