Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (13 species) not a true protein |
Species Rotavirus sp. [TaxId:10970] [195633] (1 PDB entry) |
Domain d4ds0a_: 4ds0 A: [195634] automated match to d2p3ka_ |
PDB Entry: 4ds0 (more details), 1.56 Å
SCOPe Domain Sequences for d4ds0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ds0a_ b.29.1.0 (A:) automated matches {Rotavirus sp. [TaxId: 10970]} gstldgpyqpttfnlpidywmliaptqigrvaegtnttdrwfacvlvepnvqntqreyvl dgqtvqlqvsnnsstlwkfilfiklekngaysqystlstsnklcawmkregrvywyagtt pnasesyyltinndnsnvscdaefyliprsqtelctqyinngl
Timeline for d4ds0a_: