Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Lactobacillus brevis [TaxId:387344] [195626] (1 PDB entry) |
Domain d4ecfa_: 4ecf A: [195627] automated match to d1twya_ complexed with act, edo, po4 |
PDB Entry: 4ecf (more details), 1.55 Å
SCOPe Domain Sequences for d4ecfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ecfa_ c.94.1.0 (A:) automated matches {Lactobacillus brevis [TaxId: 387344]} agesitavgstalqplveaageqytgehlgtfinvqgggtgtglsqiqegavqignsdlf ageqkginarqlvdhrvavvgitpivnkkvgvknlstnqlikiftgqitnwkevggadqs ivlinraqgsgtratfeqfglanhrsktaqeqdssgmvrsivattpgaisyvafsyvnkt vqalslnhvaptevnvttndwriwsyehlytkghptgltkafityvqspaiqntlvrqlg ylspdqmlverdanghitkt
Timeline for d4ecfa_: