SCOPe 2.08: Domain d4ecfa_: 4ecf A:

Lineage for d4ecfa_ (4ecf A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Lactobacillus brevis [TaxId:387344] [195626] (1 PDB entry)

8. Domain d4ecfa_: 4ecf A: [195627]
   automated match to d1twya_
   complexed with act, edo, po4

Details for d4ecfa_

PDB Entry: 4ecf, 1.55 Å

PDB Description: crystal structure of an abc-type phosphate transport system, periplasmic component (lvis_0633) from lactobacillus brevis atcc 367 at 1.55 a resolution

PDB Compounds: (A:) ABC-type phosphate transport system, periplasmic component

SCOPe Domain Sequences for d4ecfa_:

Sequence; same for both SEQRES and ATOM records:

>d4ecfa_ c.94.1.0 (A:) automated matches {Lactobacillus brevis [TaxId: 387344]}
agesitavgstalqplveaageqytgehlgtfinvqgggtgtglsqiqegavqignsdlf
ageqkginarqlvdhrvavvgitpivnkkvgvknlstnqlikiftgqitnwkevggadqs
ivlinraqgsgtratfeqfglanhrsktaqeqdssgmvrsivattpgaisyvafsyvnkt
vqalslnhvaptevnvttndwriwsyehlytkghptgltkafityvqspaiqntlvrqlg
ylspdqmlverdanghitkt

Timeline for d4ecfa_:

• d4ecfa_ first appeared in SCOPe 2.02
  
• d4ecfa_ appears in SCOPe 2.07