SCOPe 2.03: Domain d4eewb_: 4eew B:

Lineage for d4eewb_ (4eew B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (36 PDB entries)

8. Domain d4eewb_: 4eew B: [195625]
   automated match to d1wx9a1

Details for d4eewb_

PDB Entry: 4eew, 1.3 Å

PDB Description: Crystal structure of the Ubl domain of BAG6

PDB Compounds: (B:) Large proline-rich protein BAG6

SCOPe Domain Sequences for d4eewb_:

Sequence; same for both SEQRES and ATOM records:

>d4eewb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epdslevlvktldsqtrtfivgaqmnvkefkehiaasvsipsekqrliyqgrvlqddkkl
qeynvggkvihlver

Timeline for d4eewb_:

• d4eewb_ first appeared in SCOPe 2.02
  
• d4eewb_ appears in SCOPe 2.04
  
• d4eewb_ appears in the current release, SCOPe 2.08