Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (87 species) not a true protein |
Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [195622] (1 PDB entry) |
Domain d3qv2a_: 3qv2 A: [195623] automated match to d1g55a_ complexed with sah, so4 |
PDB Entry: 3qv2 (more details), 2.15 Å
SCOPe Domain Sequences for d3qv2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qv2a_ c.66.1.0 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} qkqvnvieffsgigglrssyerssininatfipfdineiankiysknfkeevqvknldsi sikqieslncntwfmsppcqpynnsimskhkdindpraksvlhlyrdilpylinkpkhif ienvplfkeslvfkeiyniliknqyyikdiicspidigipnsrtryyvmarltpfkneiq lhqekesmisnyldnnvnesysipsdlilkkgmlfdivgkddkrtccftksytkivegtg siycpiephfipvkkaedllnknlryftpneikkihgfssnfttqidgltdkqqyqclgn svscfviaqlmeylfddlke
Timeline for d3qv2a_: