SCOPe 2.02: Domain d3rfbb_: 3rfb B:

Lineage for d3rfbb_ (3rfb B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.0: automated matches [191507] (1 protein)
   not a true family

6. Protein automated matches [190838] (5 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:171101] [195619] (1 PDB entry)

8. Domain d3rfbb_: 3rfb B: [195621]
   automated match to d3ksfd_
   complexed with sme

Details for d3rfbb_

PDB Entry: 3rfb, 2.3 Å

PDB Description: Structure of fRMsr

PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3rfbb_:

Sequence; same for both SEQRES and ATOM records:

>d3rfbb_ d.110.2.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
mlksekqsryqmlneelsfllegetnvlanlsnasaliksrfpntvfagfylfdgkelvl
gpfqggvscirialgkgvcgeaahfqetvivgdvttylnyiscdslakseivvpmmkngq
llgvldldsseiedydamdrdyleqfvaillekttwdftmfee

Timeline for d3rfbb_:

• d3rfbb_ is new in SCOPe 2.02-stable
  
• d3rfbb_ appears in SCOPe 2.03
  
• d3rfbb_ appears in the current release, SCOPe 2.08