![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) ![]() |
![]() | Family b.61.1.0: automated matches [191402] (1 protein) not a true family |
![]() | Protein automated matches [190537] (4 species) not a true protein |
![]() | Species Shewanella denitrificans [TaxId:318161] [195517] (2 PDB entries) |
![]() | Domain d3t2xa_: 3t2x A: [195605] automated match to d1kl4b_ mutant |
PDB Entry: 3t2x (more details), 1.15 Å
SCOPe Domain Sequences for d3t2xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t2xa_ b.61.1.0 (A:) automated matches {Shewanella denitrificans [TaxId: 318161]} maqeltamsawvnqdgstlyinsinaqgeltgsyinraagaacqnspypvngwvfgtais fstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqts
Timeline for d3t2xa_: