Lineage for d3t2xc_ (3t2x C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1325092Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1325093Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1325518Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 1325519Protein automated matches [190537] (7 species)
    not a true protein
  7. 1325561Species Shewanella denitrificans [TaxId:318161] [195517] (5 PDB entries)
  8. 1325570Domain d3t2xc_: 3t2x C: [195602]
    automated match to d1kl4b_
    mutant

Details for d3t2xc_

PDB Entry: 3t2x (more details), 1.15 Å

PDB Description: Structure of shwanavidin low affinity mutant (F43A)
PDB Compounds: (C:) Avidin/streptavidin

SCOPe Domain Sequences for d3t2xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t2xc_ b.61.1.0 (C:) automated matches {Shewanella denitrificans [TaxId: 318161]}
aqeltamsawvnqdgstlyinsinaqgeltgsyinraagaacqnspypvngwvfgtaisf
stkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt

SCOPe Domain Coordinates for d3t2xc_:

Click to download the PDB-style file with coordinates for d3t2xc_.
(The format of our PDB-style files is described here.)

Timeline for d3t2xc_: