Lineage for d3sfva_ (3sfv A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363774Protein automated matches [190047] (16 species)
    not a true protein
  7. 1363812Species Human (Homo sapiens) [TaxId:9606] [186768] (113 PDB entries)
  8. 1363848Domain d3sfva_: 3sfv A: [195572]
    automated match to d2fola1
    complexed with gdp; mutant

Details for d3sfva_

PDB Entry: 3sfv (more details), 1.73 Å

PDB Description: Crystal structure of the GDP-bound Rab1a S25N mutant in complex with the coiled-coil domain of LidA from Legionella pneumophila
PDB Compounds: (A:) Ras-related protein Rab-1A

SCOPe Domain Sequences for d3sfva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sfva_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgsmssmnpeydylfkllligdsgvgknclllrfaddtytesyistigvdfkirtieldg
ktiklqiwdtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenv
nkllvgnkcdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm

SCOPe Domain Coordinates for d3sfva_:

Click to download the PDB-style file with coordinates for d3sfva_.
(The format of our PDB-style files is described here.)

Timeline for d3sfva_: