Lineage for d3stlc_ (3stl C:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252668Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2252669Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
  5. 2252670Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2252772Protein automated matches [190184] (3 species)
    not a true protein
  7. 2252781Species Streptomyces lividans [TaxId:1916] [186922] (14 PDB entries)
  8. 2252782Domain d3stlc_: 3stl C: [195570]
    Other proteins in same PDB: d3stla1, d3stla2, d3stlb1, d3stlb2
    automated match to d1s5hc_
    complexed with cd, k; mutant

Details for d3stlc_

PDB Entry: 3stl (more details), 2.4 Å

PDB Description: KcsA potassium channel mutant Y82C with Cadmium bound
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d3stlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3stlc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
cpvtlwgrlvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d3stlc_:

Click to download the PDB-style file with coordinates for d3stlc_.
(The format of our PDB-style files is described here.)

Timeline for d3stlc_: