SCOPe 2.04: Domain d3stlc_: 3stl C:

Lineage for d3stlc_ (3stl C:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein automated matches [190184] (3 species)
   not a true protein

7. Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries)

8. Domain d3stlc_: 3stl C: [195570]
   Other proteins in same PDB: d3stla1, d3stla2, d3stlb1, d3stlb2
   automated match to d1s5hc_
   complexed with cd, k; mutant

Details for d3stlc_

PDB Entry: 3stl, 2.4 Å

PDB Description: KcsA potassium channel mutant Y82C with Cadmium bound

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d3stlc_:

Sequence; same for both SEQRES and ATOM records:

>d3stlc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
cpvtlwgrlvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d3stlc_:

• d3stlc_ first appeared in SCOPe 2.02
  
• d3stlc_ appears in SCOPe 2.03
  
• d3stlc_ appears in SCOPe 2.05
  
• d3stlc_ appears in the current release, SCOPe 2.08