![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) ![]() |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
![]() | Protein automated matches [190184] (2 species) not a true protein |
![]() | Species Streptomyces lividans [TaxId:1916] [186922] (9 PDB entries) |
![]() | Domain d3stlc_: 3stl C: [195570] Other proteins in same PDB: d3stla1, d3stla2, d3stlb1, d3stlb2 automated match to d1s5hc_ complexed with cd, k; mutant |
PDB Entry: 3stl (more details), 2.4 Å
SCOPe Domain Sequences for d3stlc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3stlc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl cpvtlwgrlvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d3stlc_:
![]() Domains from other chains: (mouse over for more information) d3stla1, d3stla2, d3stlb1, d3stlb2 |