SCOPe 2.03: Domain d3vlbb_: 3vlb B:

Lineage for d3vlbb_ (3vlb B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (23 species)
   not a true protein

7. Species Fungus (Aspergillus aculeatus) [TaxId:5053] [195557] (3 PDB entries)

8. Domain d3vlbb_: 3vlb B: [195563]
   Other proteins in same PDB: d3vlba_, d3vlbc_
   automated match to d1oa2a_

Details for d3vlbb_

PDB Entry: 3vlb, 2.7 Å

PDB Description: Crystal structure of xeg-edgp

PDB Compounds: (B:) Xyloglucan-specific endo-beta-1,4-glucanase A

SCOPe Domain Sequences for d3vlbb_:

Sequence; same for both SEQRES and ATOM records:

>d3vlbb_ b.29.1.0 (B:) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
sdfcgqwdtatagdftlyndlwgesagtgsqctgvdsysgdtiawhtswswsggsssvks
yvnaaltftptqlncissipttwkwsysgssivadvaydtflaetasgsskyeimvwlaa
lggagpisstgstiatptiagvnwklysgpngdttvysfvadsttesfsgdlndfftylv
dnegvsdelylttleagtepftgsnakltvseysisie

Timeline for d3vlbb_:

• d3vlbb_ first appeared in SCOPe 2.02
  
• d3vlbb_ appears in SCOPe 2.04
  
• d3vlbb_ appears in the current release, SCOPe 2.08