Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (13 species) not a true protein |
Species Aspergillus aculeatus [TaxId:5053] [195557] (2 PDB entries) |
Domain d3vlbb_: 3vlb B: [195563] Other proteins in same PDB: d3vlba_, d3vlbc_ automated match to d1oa2a_ |
PDB Entry: 3vlb (more details), 2.7 Å
SCOPe Domain Sequences for d3vlbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vlbb_ b.29.1.0 (B:) automated matches {Aspergillus aculeatus [TaxId: 5053]} sdfcgqwdtatagdftlyndlwgesagtgsqctgvdsysgdtiawhtswswsggsssvks yvnaaltftptqlncissipttwkwsysgssivadvaydtflaetasgsskyeimvwlaa lggagpisstgstiatptiagvnwklysgpngdttvysfvadsttesfsgdlndfftylv dnegvsdelylttleagtepftgsnakltvseysisie
Timeline for d3vlbb_: