SCOPe 2.04: Domain d3vlaa_: 3vla A:

Lineage for d3vlaa_ (3vla A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.0: automated matches [191552] (1 protein)
   not a true family

6. Protein automated matches [190954] (8 species)
   not a true protein

7. Species Carrot (Daucus carota) [TaxId:4039] [195560] (2 PDB entries)

8. Domain d3vlaa_: 3vla A: [195561]
   automated match to d3hd8c_
   complexed with nag

Details for d3vlaa_

PDB Entry: 3vla, 0.95 Å

PDB Description: crystal structure of edgp

PDB Compounds: (A:) edgp

SCOPe Domain Sequences for d3vlaa_:

Sequence; same for both SEQRES and ATOM records:

>d3vlaa_ b.50.1.0 (A:) automated matches {Carrot (Daucus carota) [TaxId: 4039]}
epsfrpsalvvpvkkdastlqyvttinqrtplvsenlvvdlggrflwvdcdqnyvsstyr
pvrcrtsqcslsgsiacgdcfngprpgcnnntcgvfpenpvintatggevaedvvsvest
dgsssgrvvtvprfifscaptsllqnlasgvvgmaglgrtrialpsqfasafsfkrkfam
clsgstssnsviifgndpytflpniivsdktltytplltnpvstsatstqgepsveyfig
vksikinskivalntsllsissaglggtkistinpytvletsiykavteafikesaarni
trvasvapfgacfstdnilstrlgpsvpsidlvlqsesvvwtitgsnsmvyindnvvclg
vvdggsnlrtsivigghqlednlvqfdlatsrvgfsgtllgsrttcanfnfts

Timeline for d3vlaa_:

• d3vlaa_ first appeared in SCOPe 2.02
  
• d3vlaa_ appears in SCOPe 2.03
  
• d3vlaa_ appears in SCOPe 2.05
  
• d3vlaa_ appears in the current release, SCOPe 2.08