Class a: All alpha proteins [46456] (179 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulphide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
Protein Snake phospholipase A2 [48624] (27 species) |
Species Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId:113192] [48633] (1 PDB entry) |
Domain d1qlla_: 1qll A: [19556] |
PDB Entry: 1qll (more details), 2.04 Å
SCOP Domain Sequences for d1qlla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlla_ a.133.1.2 (A:) Snake phospholipase A2 {Bothrops pirajai, Piratoxin-II (PRTX-II)} slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadk c
Timeline for d1qlla_: