Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (10 species) not a true protein |
Species Homo sapiens [TaxId:9606] [192729] (55 PDB entries) |
Domain d4a4xa_: 4a4x A: [195555] automated match to d2w5ha_ complexed with jup |
PDB Entry: 4a4x (more details), 2.4 Å
SCOPe Domain Sequences for d4a4xa_:
Sequence, based on SEQRES records: (download)
>d4a4xa_ d.144.1.7 (A:) automated matches {Homo sapiens [TaxId: 9606]} sraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrel khpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltl alkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdedfakefvgtpyy mspeqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyrysd elneiitrmlnlkdyhrpsveeilenplilehhhhhh
>d4a4xa_ d.144.1.7 (A:) automated matches {Homo sapiens [TaxId: 9606]} sraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrel khpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltl alkechrrshrdlkpanvfldgkqnvklgdfglvgtpyymspeqmnrneksdiwslgcll yelcalmppftafsqkelagkiregkfrripyrysdelneiitrmlnlkdyhrpsveeil enplilehhhhhh
Timeline for d4a4xa_: