SCOP 1.65: Domain d2notb_: 2not B:

Lineage for d2notb_ (2not B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulphide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (27 species)

7. Species Mainland tiger snake (Notechis scutatus scutatus), notechis II-5 [TaxId:8663] [48632] (1 PDB entry)
   neurotoxic phospholipase a2

8. Domain d2notb_: 2not B: [19555]

Details for d2notb_

PDB Entry: 2not, 3 Å

PDB Description: notechis ii-5, neurotoxic phospholipase a2 from notechis scutatus scutatus

SCOP Domain Sequences for d2notb_:

Sequence; same for both SEQRES and ATOM records:

>d2notb_ a.133.1.2 (B:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notechis II-5}
nlvqfsyliqcanhgrrptrhymdygcycgwggsgtpvdeldrcckihddcysdaekkgc
spkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq

Timeline for d2notb_:

• d2notb_ first appeared (with stable ids) in SCOP 1.55
  
• d2notb_ appears in SCOP 1.63
  
• d2notb_ appears in SCOP 1.67
  
• d2notb_ appears in the current release, SCOPe 2.08