SCOPe 2.02: Domain d3rieb_: 3rie B:

Lineage for d3rieb_ (3rie B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (23 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [187826] (7 PDB entries)

8. Domain d3rieb_: 3rie B: [195538]
   automated match to d2i7ca_
   complexed with 1pg, gol, jfq, mta

Details for d3rieb_

PDB Entry: 3rie, 1.9 Å

PDB Description: the structure of plasmodium falciparum spermidine synthase in complex with 5'-methylthioadenosine and n-(3-aminopropyl)-trans-cyclohexane- 1,4-diamine

PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d3rieb_:

Sequence; same for both SEQRES and ATOM records:

>d3rieb_ c.66.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
kkwfsefsimwpgqafslkikkilyetkskyqnvlvfesttygkvlvldgviqltekdef
ayhemmthvpmtvskepknvlvvgggdggiirelckyksvenidiceidetvievskiyf
kniscgyedkrvnvfiedaskflenvtntydviivdssdpigpaetlfnqnfyekiynal
kpngycvaqceslwihvgtiknmigyakklfkkveyanisiptypcgcigilccsktdtg
ltkpnkkleskefadlkyynyenhsaafklpafllkeie

Timeline for d3rieb_:

• d3rieb_ is new in SCOPe 2.02-stable
  
• d3rieb_ appears in SCOPe 2.03
  
• d3rieb_ appears in the current release, SCOPe 2.08