![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) ![]() |
![]() | Family b.61.1.0: automated matches [191402] (1 protein) not a true family |
![]() | Protein automated matches [190537] (7 species) not a true protein |
![]() | Species Shewanella denitrificans [TaxId:318161] [195517] (5 PDB entries) |
![]() | Domain d3szib_: 3szi B: [195523] automated match to d1kl4b_ complexed with fmt |
PDB Entry: 3szi (more details), 1.4 Å
SCOPe Domain Sequences for d3szib_:
Sequence, based on SEQRES records: (download)
>d3szib_ b.61.1.0 (B:) automated matches {Shewanella denitrificans [TaxId: 318161]} ltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtaisfstk wlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
>d3szib_ b.61.1.0 (B:) automated matches {Shewanella denitrificans [TaxId: 318161]} ltamsawvnqdgstlyinsinaqgeltgsyinraafacqnspypvngwvfgtaisfstkw lnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
Timeline for d3szib_: