Lineage for d3szij1 (3szi J:3-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2806418Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2806419Protein automated matches [190537] (10 species)
    not a true protein
  7. 2806471Species Shewanella denitrificans [TaxId:318161] [195517] (5 PDB entries)
  8. 2806491Domain d3szij1: 3szi J:3-120 [195518]
    Other proteins in same PDB: d3szid2, d3szig2, d3szij2
    automated match to d1kl4b_
    complexed with fmt

Details for d3szij1

PDB Entry: 3szi (more details), 1.4 Å

PDB Description: Structure of apo shwanavidin (P21 form)
PDB Compounds: (J:) Avidin/streptavidin

SCOPe Domain Sequences for d3szij1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3szij1 b.61.1.0 (J:3-120) automated matches {Shewanella denitrificans [TaxId: 318161]}
maqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtais
fstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt

SCOPe Domain Coordinates for d3szij1:

Click to download the PDB-style file with coordinates for d3szij1.
(The format of our PDB-style files is described here.)

Timeline for d3szij1: