SCOPe 2.02: Domain d3tkgd_: 3tkg D:

Lineage for d3tkgd_ (3tkg D:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (7 species)

7. Species Human immunodeficiency virus type 1 (bh5 isolate) [TaxId:11682] [186950] (13 PDB entries)

8. Domain d3tkgd_: 3tkg D: [195514]
   automated match to d2aoda_
   complexed with cl, gol, roc

Details for d3tkgd_

PDB Entry: 3tkg, 1.36 Å

PDB Description: crystal structure of hiv model protease precursor/saquinavir complex

PDB Compounds: (D:) Protease

SCOPe Domain Sequences for d3tkgd_:

Sequence; same for both SEQRES and ATOM records:

>d3tkgd_ b.50.1.1 (D:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bh5 isolate) [TaxId: 11682]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d3tkgd_:

• d3tkgd_ is new in SCOPe 2.02-stable
  
• d3tkgd_ appears in SCOPe 2.03
  
• d3tkgd_ appears in the current release, SCOPe 2.08