Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.6: AlbA-like [82704] (3 families) |
Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins) |
Protein automated matches [190221] (3 species) not a true protein |
Species Methanothermobacter thermautotrophicus [TaxId:187420] [195510] (1 PDB entry) |
Domain d3toea_: 3toe A: [195512] automated match to d1nfja_ |
PDB Entry: 3toe (more details), 2.2 Å
SCOPe Domain Sequences for d3toea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3toea_ d.68.6.1 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]} nvvyignkpvmnyvlavvtqmnggtsevilkargiaisravdvaeivrnrfipdiqieni dicteeiignegtatnvsaieiqlrk
Timeline for d3toea_: