SCOPe 2.02: Domain d4dija_: 4dij A:

Lineage for d4dija_ (4dij A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (25 PDB entries)

8. Domain d4dija_: 4dij A: [195473]
   automated match to d3jzra_
   complexed with blf

Details for d4dija_

PDB Entry: 4dij, 1.9 Å

PDB Description: the central valine concept provides an entry in a new class of non peptide inhibitors of the p53-mdm2 interaction

PDB Compounds: (A:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4dija_:

Sequence; same for both SEQRES and ATOM records:

>d4dija_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
qipaseqetlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
sndllgdlfgvpsfsvkehrkiytmiyrnlvvv

Timeline for d4dija_:

• d4dija_ is new in SCOPe 2.02-stable
  
• d4dija_ appears in SCOPe 2.03
  
• d4dija_ appears in the current release, SCOPe 2.08