SCOPe 2.05: Domain d4djna_: 4djn A:

Lineage for d4djna_ (4djn A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193902] (6 PDB entries)

8. Domain d4djna_: 4djn A: [195471]
   automated match to d2uw2a1
   complexed with edo, so4

Details for d4djna_

PDB Entry: 4djn, 2.2 Å

PDB Description: crystal structure of a ribonucleotide reductase m2 b (rnrr2) from homo sapiens at 2.20 a resolution

PDB Compounds: (A:) ribonucleoside-diphosphate reductase subunit m2 b

SCOPe Domain Sequences for d4djna_:

Sequence; same for both SEQRES and ATOM records:

>d4djna_ a.25.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksneepllrkssrrfvifpiqypdiwkmykqaqasfwtaeevdlskdlphwnklkadeky
fishilaffaasdgivnenlverfsqevqvpearcfygfqilienvhsemysllidtyir
dpkkreflfnaietmpyvkkkadwalrwiadrkstfgervvafaavegvffsgsfaaifw
lkkrglmpgltfsnelisrdeglhcdfaclmfqylvnkpseervreiivdavkieqeflt
ealpvgligmncilmkqyiefvadrllvelgfskvfqaenpfdfmen

Timeline for d4djna_:

• d4djna_ first appeared in SCOPe 2.02
  
• d4djna_ appears in SCOPe 2.04
  
• d4djna_ appears in SCOPe 2.06
  
• d4djna_ appears in the current release, SCOPe 2.08