Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (23 species) not a true protein |
Domain d3cbga_: 3cbg A: [195467] automated match to d3tr6a_ complexed with 4fe, fer, mg, sah |
PDB Entry: 3cbg (more details), 2 Å
SCOPe Domain Sequences for d3cbga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cbga_ c.66.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1148]} kgitgfdpslysylqsisaddsfylaqlrretahlpgapmqispeqaqflgllisltgak qvleigvfrgysalamalqlppdgqiiacdqdpnataiakkywqkagvaekislrlgpal atleqltqgkplpefdlifidadkrnypryyeiglnllrrgglmvidnvlwhgkvtevdp qeaqtqvlqqfnrdlaqdervrisviplgdgmtlalkk
Timeline for d3cbga_: