Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (5 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [195450] (1 PDB entry) |
Domain d2vn1b_: 2vn1 B: [195451] automated match to d3ni6a_ complexed with fk5 |
PDB Entry: 2vn1 (more details), 2.35 Å
SCOPe Domain Sequences for d2vn1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vn1b_ d.26.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]} efekveltadggviktilkkgdegeenipkkgnevtvhyvgklestgkvfdssfdrnvpf kfhleqgevikgwdicvssmrknekclvriesmygygdegcgesipgnsvllfeiellsf rele
Timeline for d2vn1b_: