Lineage for d3rj6b_ (3rj6 B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1074991Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1076387Protein Myoglobin [46469] (9 species)
  7. 1076392Species Horse (Equus caballus) [TaxId:9796] [46474] (61 PDB entries)
  8. 1076401Domain d3rj6b_: 3rj6 B: [195448]
    automated match to d1nz3a_
    complexed with hem, so4; mutant

Details for d3rj6b_

PDB Entry: 3rj6 (more details), 1.23 Å

PDB Description: crystal structure of horse heart ferric myoglobin; k45e/k63e/k96e mutant
PDB Compounds: (B:) Myoglobin

SCOPe Domain Sequences for d3rj6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rj6b_ a.1.1.2 (B:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdefkhlkteaemkased
lkehgtvvltalggilkkkghheaelkplaqshatehkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

SCOPe Domain Coordinates for d3rj6b_:

Click to download the PDB-style file with coordinates for d3rj6b_.
(The format of our PDB-style files is described here.)

Timeline for d3rj6b_: