SCOPe 2.02: Domain d3rj6a_: 3rj6 A:

Lineage for d3rj6a_ (3rj6 A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (61 PDB entries)

8. Domain d3rj6a_: 3rj6 A: [195447]
   automated match to d1nz3a_
   complexed with hem, so4; mutant

Details for d3rj6a_

PDB Entry: 3rj6, 1.23 Å

PDB Description: crystal structure of horse heart ferric myoglobin; k45e/k63e/k96e mutant

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3rj6a_:

Sequence; same for both SEQRES and ATOM records:

>d3rj6a_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdefkhlkteaemkased
lkehgtvvltalggilkkkghheaelkplaqshatehkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Timeline for d3rj6a_:

• d3rj6a_ is new in SCOPe 2.02-stable
  
• d3rj6a_ appears in SCOPe 2.03
  
• d3rj6a_ appears in the current release, SCOPe 2.08