SCOPe 2.02: Domain d3rvka_: 3rvk A:

Lineage for d3rvka_ (3rvk A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [195427] (6 PDB entries)

8. Domain d3rvka_: 3rvk A: [195432]
   automated match to d1djma_
   complexed with mn

Details for d3rvka_

PDB Entry: 3rvk, 1.16 Å

PDB Description: structure of the chey-mn2+ complex with substitutions at 59 and 89: n59d e89q

PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3rvka_:

Sequence; same for both SEQRES and ATOM records:

>d3rvka_ c.23.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
madkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwdm
pnmdglellktiradgamsalpvlmvtaqakkeniiaaaqagasgyvvkpftaatleekl
nkifeklgm

Timeline for d3rvka_:

• d3rvka_ is new in SCOPe 2.02-stable
  
• d3rvka_ appears in SCOPe 2.03
  
• d3rvka_ appears in the current release, SCOPe 2.08