Lineage for d3rvjb_ (3rvj B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1837704Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1837982Protein automated matches [190177] (6 species)
    not a true protein
  7. 1837990Species Escherichia coli K-12 [TaxId:83333] [189043] (17 PDB entries)
  8. 1838012Domain d3rvjb_: 3rvj B: [195431]
    automated match to d1djma_
    complexed with bef, gol, mn, so4

Details for d3rvjb_

PDB Entry: 3rvj (more details), 2.1 Å

PDB Description: structure of the chey-bef3 complex with substitutions at 59 and 89: n59d and e89q
PDB Compounds: (B:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3rvjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rvjb_ c.23.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
hmadkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwd
mpnmdglellktiradgamsalpvlmvtaqakkeniiaaaqagasgyvvkpftaatleek
lnkifeklgm

SCOPe Domain Coordinates for d3rvjb_:

Click to download the PDB-style file with coordinates for d3rvjb_.
(The format of our PDB-style files is described here.)

Timeline for d3rvjb_: