SCOPe 2.05: Domain d3rvra_: 3rvr A:

Lineage for d3rvra_ (3rvr A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (6 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189043] (17 PDB entries)

8. Domain d3rvra_: 3rvr A: [195430]
   automated match to d1djma_
   complexed with gol, mn, moo, so4

Details for d3rvra_

PDB Entry: 3rvr, 2.1 Å

PDB Description: structure of the cheyn59d/e89r molybdate complex

PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3rvra_:

Sequence; same for both SEQRES and ATOM records:

>d3rvra_ c.23.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
hmadkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwd
mpnmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleek
lnkifeklgm

Timeline for d3rvra_:

• d3rvra_ first appeared in SCOPe 2.02
  
• d3rvra_ appears in SCOPe 2.04
  
• d3rvra_ is called d3rvra1 in SCOPe 2.06
  
• d3rvra_ appears in the current release, SCOPe 2.08, called d3rvra1