SCOPe 2.03: Domain d3stvb_: 3stv B:

Lineage for d3stvb_ (3stv B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (40 species)
   not a true protein

7. Species Lycopersicon hirsutum [TaxId:283673] [195413] (6 PDB entries)

8. Domain d3stvb_: 3stv B: [195418]
   automated match to d2wfla_
   complexed with 3ho, br

Details for d3stvb_

PDB Entry: 3stv, 2.2 Å

PDB Description: crystal structure of tomato methylketone synthase i complexed with 3- hydroxyoctanoate

PDB Compounds: (B:) Methylketone synthase 1

SCOPe Domain Sequences for d3stvb_:

Sequence; same for both SEQRES and ATOM records:

>d3stvb_ c.69.1.0 (B:) automated matches {Lycopersicon hirsutum [TaxId: 283673]}
spfvkkhfvlvhtafhgawcwykivalmrssghnvtaldlgasginpkqalqipnfsdyl
splmefmaslpanekiilvghalgglaiskametfpekisvavflsglmpgpnidattvc
tkagsavlgqldncvtyengptnppttliagpkflatnvyhlspiedlalatalvrplyl
ylaediskevvlsskrygsvkrvfivatendalkkeflklmieknppdevkeiegsdhvt
mmskpqqlfttllsiankyk

Timeline for d3stvb_:

• d3stvb_ first appeared in SCOPe 2.02
  
• d3stvb_ appears in SCOPe 2.04
  
• d3stvb_ appears in the current release, SCOPe 2.08