Lineage for d3utwa_ (3utw A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022990Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 3022991Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 3022992Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. 3022997Protein Bacteriorhodopsin [56871] (3 species)
    a light-driven proton pump
  7. 3023143Species Halobacterium sp. [TaxId:64091] [346420] (7 PDB entries)
  8. 3023146Domain d3utwa_: 3utw A: [195405]
    automated match to d1cwqa_
    complexed with bog, mc3, ret; mutant

Details for d3utwa_

PDB Entry: 3utw (more details), 2.4 Å

PDB Description: crystal structure of bacteriorhodopsin mutant p50a/y57f
PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d3utwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3utwa_ f.13.1.1 (A:) Bacteriorhodopsin {Halobacterium sp. [TaxId: 64091]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvaaiaftmflsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg

SCOPe Domain Coordinates for d3utwa_:

Click to download the PDB-style file with coordinates for d3utwa_.
(The format of our PDB-style files is described here.)

Timeline for d3utwa_: