Lineage for d3vh9a_ (3vh9 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1173024Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1173859Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 1174039Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)
  6. 1174160Protein automated matches [190049] (2 species)
    not a true protein
  7. 1174168Species Vibrio proteolyticus [TaxId:671] [186859] (5 PDB entries)
  8. 1174170Domain d3vh9a_: 3vh9 A: [195397]
    automated match to d1rtqa_
    complexed with cl, gol, hqy, na, scn, zn

Details for d3vh9a_

PDB Entry: 3vh9 (more details), 1.29 Å

PDB Description: Crystal structure of Aeromonas proteolytica aminopeptidase complexed with 8-quinolinol
PDB Compounds: (A:) Bacterial leucyl aminopeptidase

SCOPe Domain Sequences for d3vh9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vh9a_ c.56.5.4 (A:) automated matches {Vibrio proteolyticus [TaxId: 671]}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

SCOPe Domain Coordinates for d3vh9a_:

Click to download the PDB-style file with coordinates for d3vh9a_.
(The format of our PDB-style files is described here.)

Timeline for d3vh9a_: