Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
Protein automated matches [191087] (5 species) not a true protein |
Species Trypanosoma brucei [TaxId:999953] [195043] (3 PDB entries) |
Domain d4f36a_: 4f36 A: [195366] automated match to d3prvb_ complexed with scn |
PDB Entry: 4f36 (more details), 2.3 Å
SCOPe Domain Sequences for d4f36a_:
Sequence, based on SEQRES records: (download)
>d4f36a_ d.58.6.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]} sertfiavkpdgvqrnlvgeiikrfenkgyklvglkllqpteeqakqhyidlaskpfysg lvsyfssgpivgmvweglgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgsdsv esakreiafwfkaeelvswtshsvkqiye
>d4f36a_ d.58.6.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]} sertfiavkpdgvqrnlvgeiikrfenkgyklvglkllqpteeqakqhfysglvsyfssg pivgmvweglgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgsdsvesakreia fwfkaeelvswtshsvkqiye
Timeline for d4f36a_: