Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.70: Nucleoside hydrolase [53589] (1 superfamily) core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest |
Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) |
Family c.70.1.0: automated matches [191403] (1 protein) not a true family |
Protein automated matches [190539] (4 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:273057] [195362] (1 PDB entry) |
Domain d3t8ja_: 3t8j A: [195363] automated match to d3g5ia_ complexed with na |
PDB Entry: 3t8j (more details), 1.6 Å
SCOPe Domain Sequences for d3t8ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t8ja_ c.70.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]} mrhfiidcdtaeddvlslylllknnidvvavtivegnisyeqevknalwaleqvnreipv ypgankpllknyitvekvhgkggigdvtvepkrlkaqekhaalaiidlaneyagelefla ispltnlalaylldnsivkkikkvwvmggavfgignitpvaefniwvdpdaakivfnagf ditmipwdviinypvtdeewnviknmktrmselyvsmylhyrqysstvqkinghphpdai ttaiaidgsiatrrekrfvvidntdnitrgmtlvdrfdadtswsdkpnaeivyeinkksf mekiydllnwf
Timeline for d3t8ja_: