Lineage for d3t8ja_ (3t8j A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903313Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2903314Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2903387Family c.70.1.0: automated matches [191403] (1 protein)
    not a true family
  6. 2903388Protein automated matches [190539] (7 species)
    not a true protein
  7. 2903427Species Sulfolobus solfataricus [TaxId:273057] [195362] (1 PDB entry)
  8. 2903428Domain d3t8ja_: 3t8j A: [195363]
    automated match to d3g5ia_
    complexed with na

Details for d3t8ja_

PDB Entry: 3t8j (more details), 1.6 Å

PDB Description: Structural analysis of thermostable S. solfataricus pyrimidine-specific nucleoside hydrolase
PDB Compounds: (A:) Purine nucleosidase, (IunH-1)

SCOPe Domain Sequences for d3t8ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t8ja_ c.70.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mrhfiidcdtaeddvlslylllknnidvvavtivegnisyeqevknalwaleqvnreipv
ypgankpllknyitvekvhgkggigdvtvepkrlkaqekhaalaiidlaneyagelefla
ispltnlalaylldnsivkkikkvwvmggavfgignitpvaefniwvdpdaakivfnagf
ditmipwdviinypvtdeewnviknmktrmselyvsmylhyrqysstvqkinghphpdai
ttaiaidgsiatrrekrfvvidntdnitrgmtlvdrfdadtswsdkpnaeivyeinkksf
mekiydllnwf

SCOPe Domain Coordinates for d3t8ja_:

Click to download the PDB-style file with coordinates for d3t8ja_.
(The format of our PDB-style files is described here.)

Timeline for d3t8ja_: