Lineage for d2yflf_ (2yfl F:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1196747Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1197160Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1197397Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 1197444Protein automated matches [190223] (3 species)
    not a true protein
  7. 1197445Species Burkholderia xenovorans [TaxId:266265] [189543] (7 PDB entries)
  8. 1197502Domain d2yflf_: 2yfl F: [195351]
    automated match to d2xsob_
    complexed with dc4, fe2, fes

Details for d2yflf_

PDB Entry: 2yfl (more details), 2.6 Å

PDB Description: Crystal Structure of Biphenyl dioxygenase variant RR41 with 2-chloro dibenzofuran
PDB Compounds: (F:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d2yflf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yflf_ d.17.4.4 (F:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff

SCOPe Domain Coordinates for d2yflf_:

Click to download the PDB-style file with coordinates for d2yflf_.
(The format of our PDB-style files is described here.)

Timeline for d2yflf_: