Lineage for d2yfll_ (2yfl L:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543693Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2543749Protein automated matches [190223] (5 species)
    not a true protein
  7. 2543750Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries)
  8. 2543822Domain d2yfll_: 2yfl L: [195349]
    Other proteins in same PDB: d2yfla1, d2yfla2, d2yflc1, d2yflc2, d2yfle1, d2yfle2, d2yflg1, d2yflg2, d2yfli1, d2yfli2, d2yflk1, d2yflk2
    automated match to d2xsob_
    complexed with dc4, fe2, fes

Details for d2yfll_

PDB Entry: 2yfl (more details), 2.6 Å

PDB Description: Crystal Structure of Biphenyl dioxygenase variant RR41 with 2-chloro dibenzofuran
PDB Compounds: (L:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d2yfll_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yfll_ d.17.4.4 (L:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff

SCOPe Domain Coordinates for d2yfll_:

Click to download the PDB-style file with coordinates for d2yfll_.
(The format of our PDB-style files is described here.)

Timeline for d2yfll_: