Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (17 species) not a true protein |
Species Maize (Zea mays) [TaxId:4577] [195345] (1 PDB entry) |
Domain d4anma1: 4anm A:7-333 [195346] Other proteins in same PDB: d4anma2 automated match to d1f0qa_ complexed with wul |
PDB Entry: 4anm (more details), 1.7 Å
SCOPe Domain Sequences for d4anma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4anma1 d.144.1.7 (A:7-333) automated matches {Maize (Zea mays) [TaxId: 4577]} skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr ydhqerltaleamthpyfqqvraaens
Timeline for d4anma1: