SCOPe 2.06: Domain d4anma1: 4anm A:7-333

Lineage for d4anma1 (4anm A:7-333)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (17 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [195345] (1 PDB entry)

8. Domain d4anma1: 4anm A:7-333 [195346]
   Other proteins in same PDB: d4anma2
   automated match to d1f0qa_
   complexed with wul

Details for d4anma1

PDB Entry: 4anm, 1.7 Å

PDB Description: Complex of CK2 with a CDC7 inhibitor

PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d4anma1:

Sequence; same for both SEQRES and ATOM records:

>d4anma1 d.144.1.7 (A:7-333) automated matches {Maize (Zea mays) [TaxId: 4577]}
skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
ydhqerltaleamthpyfqqvraaens

Timeline for d4anma1:

• d4anma1 first appeared in SCOPe 2.02, called d4anma_
  
• d4anma1 was called d4anma_ in SCOPe 2.05
  
• d4anma1 appears in SCOPe 2.07
  
• d4anma1 appears in the current release, SCOPe 2.08