Lineage for d3azca_ (3azc A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535669Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1535670Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1535671Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 1535751Protein automated matches [190874] (7 species)
    not a true protein
  7. 1535768Species Thermosynechococcus elongatus [TaxId:197221] [195343] (1 PDB entry)
  8. 1535769Domain d3azca_: 3azc A: [195344]
    automated match to d1q90c_
    complexed with fes

Details for d3azca_

PDB Entry: 3azc (more details), 2 Å

PDB Description: Crystal structure of the soluble part of cytochrome b6f complex iron-sulfur subunit from Thermosynechococcus elongatus BP-1
PDB Compounds: (A:) Cytochrome b6-f complex iron-sulfur subunit

SCOPe Domain Sequences for d3azca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3azca_ b.33.1.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
hhiegravakdalgndikvseylakhlpgdrslaqgikgdptyvivtedhqianyglnav
cthlgcvvpwnvsenkficpchgsqydstgkvvrgpaplslalvkatvteddklvftpwt
eidfrtgkepwwt

SCOPe Domain Coordinates for d3azca_:

Click to download the PDB-style file with coordinates for d3azca_.
(The format of our PDB-style files is described here.)

Timeline for d3azca_: