Lineage for d3ay7b_ (3ay7 B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1151047Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1152087Protein automated matches [190085] (34 species)
    not a true protein
  7. 1152112Species Bacillus megaterium [TaxId:1404] [195340] (3 PDB entries)
  8. 1152113Domain d3ay7b_: 3ay7 B: [195342]
    automated match to d1gcoa_
    complexed with cl; mutant

Details for d3ay7b_

PDB Entry: 3ay7 (more details), 1.9 Å

PDB Description: Crystal structure of Bacillus megaterium glucose dehydrogenase 4 G259A mutant
PDB Compounds: (B:) Glucose 1-dehydrogenase 4

SCOPe Domain Sequences for d3ay7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ay7b_ c.2.1.2 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
hmytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkeveeaggqa
iivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkvidtnltg
aflgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetlaleyapk
girvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaaflassqasyv
tgitlfadggmtkypsfqa

SCOPe Domain Coordinates for d3ay7b_:

Click to download the PDB-style file with coordinates for d3ay7b_.
(The format of our PDB-style files is described here.)

Timeline for d3ay7b_: